PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013603558.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 353aa    MW: 40826.4 Da    PI: 7.4305
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013603558.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-1694139147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+ +G+ +W++Ia++++ gR++k+c++rw++ 
   XP_013603558.1  94 RGHWRPAEDVKLKELVAIYGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 139
                      899*****************************.***********996 PP

2Myb_DNA-binding57.23.7e-18146189146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T++E+e+l +a++++G++ W+ Iar ++ gRt++++k++w+ 
   XP_013603558.1 146 RRAFTEDEEERLMQAHRLYGNK-WAMIARLFP-GRTDNSVKNHWHV 189
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.75489140IPR017930Myb domain
SMARTSM007173.9E-1493142IPR001005SANT/Myb domain
PfamPF002496.3E-1694139IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-2894187IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-2595147IPR009057Homeodomain-like
CDDcd001673.42E-1297138No hitNo description
PROSITE profilePS5129427.162141195IPR017930Myb domain
SMARTSM007171.6E-14145193IPR001005SANT/Myb domain
PfamPF002494.8E-15146188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-21148194IPR009057Homeodomain-like
CDDcd001675.71E-11148188No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MFILEKQWRT DEVAAARREA SPWDFPFNDI NVQHHRRCNT SHEFDILKSP VGDNVEGSNN  60
HNPNYSNNES GKKETTNSGQ SWSSSSSKPS VLGRGHWRPA EDVKLKELVA IYGPQNWNLI  120
AEKLQGRSGK SCRLRWFNQL DPRINRRAFT EDEEERLMQA HRLYGNKWAM IARLFPGRTD  180
NSVKNHWHVI MARKYREHSS AYRRRKLMIN NPLKPHLSNH PSPNPNHHSF ISTHHYFTQP  240
FHEFNLTHHL VNNASITPDH NQLVLPFHCF QGYESNETPM VVSMFGNQIM GGDNVGVMSE  300
GLYDYPYIDS TSHEKGVPNE PRSWIGMEGE DEEVVETAKQ QPHFFDFLGL GTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-31921942104MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-31911941104C-Myb DNA-Binding Domain
1msf_C4e-31911941104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3348160.0AF334816.1 Arabidopsis thaliana putative transcription factor (MYB117) mRNA, complete cds.
GenBankAY5195590.0AY519559.1 Arabidopsis thaliana MYB transcription factor (At1g26780) mRNA, complete cds.
GenBankDQ4462910.0DQ446291.1 Arabidopsis thaliana clone pENTR221-At1g26780 myb family transcription factor (At1g26780) mRNA, complete cds.
GenBankDQ6528620.0DQ652862.1 Arabidopsis thaliana clone 0000017266_0000012084 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013674909.10.0PREDICTED: transcriptional activator Myb-like
RefseqXP_013603558.10.0PREDICTED: transcriptional activator Myb-like
TrEMBLA0A078I7790.0A0A078I779_BRANA; BnaCnng12230D protein
TrEMBLA0A0D3DR950.0A0A0D3DR95_BRAOL; Uncharacterized protein
STRINGBra016285.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26780.20.0myb domain protein 117